.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y7m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title B. subtilis ykuD protein at 2.0 A resolution: insights into the structure and function of a novel, ubiquitous family of bacterial enzymes. Proteins 62 144-151 2006
    Site MCSG
    PDB Id 1y7m Target Id APC1283
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4525,O34816, 1423 Molecular Weight 17642.42 Da.
    Residues 164 Isoelectric Point 9.95
    Sequence mltyqvkqgdtlnsiaadfristaallqanpslqagltagqsivipglpdpytipyhiavsigaktltl slnnrvmktypiavgkiltqtptgefyiinrqrnpggpfgaywlslskqhygihgtnnpasigkavskg cirmhnkdvielasivpngtrvtinr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.05 Rfree 0.27
    Matthews' coefficent 2.40 Rfactor 0.211
    Waters 156 Solvent Content 48.50

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals CD (CADMIUM) x 2

    Jmol

     
    Google Scholar output for 1y7m
    1. Toward rational protein crystallization: A Web server for the design of crystallizable protein variants
    L Goldschmidt, DR Cooper, ZS Derewenda - Protein , 2007 - Wiley Online Library
     
    2. The novel Cladosporium fulvum lysin motif effector Ecp6 is a virulence factor with orthologues in other fungal species
    MD Bolton, HP Van Esse, JH Vossen - Molecular , 2008 - Wiley Online Library
     
    3. LysM domains from Pteris ryukyuensis chitinase-A
    T Ohnuma, S Onaga, K Murata, T Taira - Journal of Biological , 2008 - ASBMB
     
    4. B. subtilis ykuD protein at 2.0 resolution: Insights into the structure and function of a novel, ubiquitous family of bacterial enzymes
    J Bielnicki, Y Devedjiev, U Derewenda - PROTEINS: , 2006 - Wiley Online Library
     
    5. Crystal structure of a novel _-lactam-insensitive peptidoglycan transpeptidase
    S Biarrotte-Sorin, JE Hugonnet, V Delfosse - Journal of molecular , 2006 - Elsevier
     
    6. Folds and activities of peptidoglycan amidases
    M Firczuk, M Bochtler - FEMS microbiology reviews, 2007 - Wiley Online Library
     
    7. Murein and pseudomurein cell wall binding domains of bacteria and archaeaa comparative view
    GRR Visweswaran, BW Dijkstra, J Kok - Applied microbiology and , 2011 - Springer
     
    8. Dynamics Induced by _-Lactam Antibiotics in the Active Site of Bacillus subtilis l, d-Transpeptidase
    L Lecoq, C Bougault, JE Hugonnet, C Veckerl - Structure, 2012 - Elsevier
     
    9. A genetically engineered protein domain binding to bacterial murein, archaeal pseudomurein, and fungal chitin cell wall material
    GRR Visweswaran, BW Dijkstra, J Kok - Applied Microbiology and , 2012 - Springer
     
    10. 3D-structure Modeling for Regular Segments of Low Homology Unknown Structure Protein
    Y Zhang, Z Peng - Networking, Sensing and Control, 2007 IEEE , 2007 - ieeexplore.ieee.org
     
    11. In silico sequence and structure analysis for mycobacteriophages
    V Rajendran, S Hassan, J Joseph - Asian Pacific Journal of , 2012 - apjtb.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch