.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y89

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of devB protein. To be Published
    Site MCSG
    PDB Id 1y89 Target Id APC27066
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar eltor str. n16961
    Alias Ids TPS5373,AAF96794, 243277 Molecular Weight 25802.70 Da.
    Residues 238 Isoelectric Point 5.40
    Sequence minhkifptadavvksladdmlaysqqgqpvhislsggstpkmlfkllasqpyandiqwknlhfwwgde rcvapddaesnygeanallfskinmpaqnihrilgenepqaeaerfaqamahviptengtpvfdwillg vgadghtaslfpgqtdyadanlsvvashpesgqlrvsktakvlqaakrisylvlgagkaeiveqihttp aeqlpypaakihstsgvtewyldsdaaakia
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.19434
    Matthews' coefficent 3.68 Rfactor 0.15901
    Waters 597 Solvent Content 66.00

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 6;PE5 (3,6,9,12,15,18,21,24-OCTAOXAHEXACOSAN-1-OL) x 2;2PE (NONAETHYLENE) x 1;PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals

    Jmol

     
    Google Scholar output for 1y89
    1. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    2. Three Dimensional Structure and Implications for the Catalytic Mechanism of 6-Phosphogluconolactonase from Trypanosoma brucei
    M Delarue, N Duclert-Savatier, E Miclet - Journal of molecular , 2007 - Elsevier
     
    3. Determination of dihedral _ angles in large proteins by combining NHN/C_H_ dipole/dipole cross_correlation and chemical shifts
    K Loth, D Abergel, P Pelupessy - Proteins: Structure, , 2006 - Wiley Online Library
     
    4. Insights into the enzymatic mechanism of 6-phosphogluconolactonase from Trypanosoma brucei using structural data and molecular dynamics simulation
    N Duclert-Savatier, L Poggi, E Miclet, P Lopes - Journal of molecular , 2009 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch