.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y9k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A crystal structure of IAA acetyltransferase from Bacillus cereus. To be Published
    Site MCSG
    PDB Id 1y9k Target Id APC24680
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5301,AAP08553, 226900 Molecular Weight 17307.35 Da.
    Residues 155 Isoelectric Point 8.83
    Sequence msvvieripkeaipkslllladpserqiatyvqrgltyvakqggsvigvyvlletrpktmeimniavae hlqgkgigkkllrhavetakgygmsklevgtgnssvsqlalyqkcgfrifsidfdyfskhyeeeiieng ivcrdmirlamelnknv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.39 Rfree 0.23464
    Matthews' coefficent 3.61 Rfactor 0.19841
    Waters 280 Solvent Content 65.65

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch