.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yb2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a putative methyltransferase from Thermoplasma acidophilum. To be Published
    Site MCSG
    PDB Id 1yb2 Target Id APC20012
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS5190,CAC11981, 2303 Molecular Weight 28471.12 Da.
    Residues 255 Isoelectric Point 5.89
    Sequence mkrsspvilvsedeygkfdestnsilvkgkmhhlgisrviepgdelivsgksfivsdfspmyfgrvirr ntqiiseidasyiimrcglrpgmdilevgvgsgnmssyilyalngkgtltvverdednlkkamdnlsef ydignvrtsrsdiadfisdqmydaviadipdpwnhvqkiasmmkpgsvatfylpnfdqsektvlslsas gmhhletvelmkrrilvregatrpasddlthtafitfaikksgmvyri
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.01 Rfree 0.24718
    Matthews' coefficent 2.40 Rfactor 0.19907
    Waters 132 Solvent Content 49.30

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yb2
    1. Difference in kinetic behaviour of catechol 2, 3-dioxygenase variants from a polluted environment
    H Junca, I Plumeier, HJ Hecht, DH Pieper - Microbiology, 2004 - Soc General Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch