.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yb4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of GarR-tartronate semialdehyde reductase from Salmonella typhimurium. J Struct Funct Genomics 10 249-253 2009
    Site MCSG
    PDB Id 1yb4 Target Id APC24328
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS5292,NP_459514, 99287 Molecular Weight 30976.04 Da.
    Residues 292 Isoelectric Point 5.66
    Sequence mklgfiglgimgspmainlaraghqlhvttigpvadellslgavnvetarqvtefadiifimvpdtpqv edvlfgehgcaktslqgktivdmssispietkrfaqrvnemgadyldapvsggeigaregtlsimvgge qkvfdrvkplfdilgknitlvggngdgqtckvanqiivalnieavsealvfaskagadpvrvrqalmgg fassrilevhgerminrtfepgfkialhqkdlnlalqsakalalnlpntatcqelfntcaanggsqldh samvqalelmanhkls
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.304
    Matthews' coefficent 2.48 Rfactor 0.229
    Waters 211 Solvent Content 50.40

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yb4
    1. Structural and Kinetic Properties of a _-Hydroxyacid Dehydrogenase Involved in Nicotinate Fermentation
    S Reitz, A Alhapel, LO Essen, AJ Pierik - Journal of molecular biology, 2008 - Elsevier
     
    2. X-Ray crystal structure of GarRtartronate semialdehyde reductase from Salmonella typhimurium
    J Osipiuk, M Zhou, S Moy, F Collart - Journal of structural and , 2009 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch