The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of MCSG TArget APC22750 from Bacillus cereus. To be Published
    Site MCSG
    PDB Id 1ybb Target Id APC22750
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5233,AAP07999, 226900, Molecular Weight 11034.16 Da.
    Residues 103 Isoelectric Point 4.76
    Sequence mivtttsgiqgkeiieyidivngeaimganivrdlfasvrdvvggragsyesklkeardiamdemkelak qkganaivgvdvdyevvrdgmlmvavsgtavri
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.09 Rfree 0.27655
    Matthews' coefficent 2.20 Rfactor 0.21015
    Waters 184 Solvent Content 43.00

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch