.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yhf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of conserved hypothetical SPy1581 protein from Streptococcus pyogenes. To be Published
    Site MCSG
    PDB Id 1yhf Target Id APC80041
    Molecular Characteristics
    Source Streptococcus pyogenes m1 gas
    Alias Ids TPS5579,AAK34365, 160490 Molecular Weight 12367.62 Da.
    Residues 112 Isoelectric Point 4.60
    Sequence msyinniehakvldltqevmieqdqmlsrtlvqrqdlgitvfsldkgqeigrhsspgdamvtilsglae itidqetyrvaegqtivmpagiphalyaveafqmllvvvkpea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.248
    Matthews' coefficent 2.30 Rfactor 0.19
    Waters 103 Solvent Content 45.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yhf
    1. HP0902 from Helicobacter pylori is a thermostable, dimeric protein belonging to an all-_ topology of the cupin superfamily
    DW Sim, YS Lee, JH Kim, MD Seo, BJ Lee, HS Won - proteins, 2009 - jbmb.or.kr
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch