.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yln

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the hypothetical protein vca0042 from Vibrio cholerae O1. To be Published
    Site MCSG
    PDB Id 1yln Target Id APC27154
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar eltor str. n16961
    Alias Ids TPS5378,AAF95956, 243277 Molecular Weight 28379.04 Da.
    Residues 252 Isoelectric Point 8.66
    Sequence mnsrpaekidnndgqtetprsktvstinstdalamvehsseltlsittpvgtkfvcrtpfigthtdkfl lvempkisaddlqyffqegfwmniraisprgegalihfrsqlmhilqepvpmaflsipntmqvsqlrke prfelnlagkvlfdehrgdcelrdlsrsgcrfitpplgktyqvgdlvaleifsdlrgtktfppltgkic nlqrslhharyglefneegrnnaknllaqlkfngtkltlnaekka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.243
    Matthews' coefficent 2.71 Rfactor 0.21
    Waters 135 Solvent Content 52.93

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yln
    1. The structural basis of cyclic diguanylate signal transduction by PilZ domains
    J Benach, SS Swaminathan, R Tamayo - The EMBO , 2007 - nature.com
     
    2. NMR structure and binding studies confirm that PA4608 from Pseudomonas aeruginosa is a PilZ domain and ac_di_GMP binding protein
    TA Ramelot, A Yee, JR Cort, A Semesi - Proteins: Structure, , 2007 - Wiley Online Library
     
    3. Alg44, a unique protein required for alginate biosynthesis in Pseudomonas aeruginosa
    U Remminghorst, BHA Rehm - FEBS letters, 2006 - Elsevier
     
    4. Structural basis for c-di-GMP-mediated inside-out signaling controlling periplasmic proteolysis
    MVAS Navarro, PD Newell, PV Krasteva, D Chatterjee - PLoS biology, 2011 - dx.plos.org
     
    5. The role of PilZ domain proteins in the virulence of Xanthomonas campestris pv. campestris
    Y Mccarthy, RP RYAN, K O'DONOVAN - Molecular plant , 2008 - Wiley Online Library
     
    6. PILZ protein structure and interactions with PILB and the FIMX EAL domain: implications for control of type IV pilus biogenesis
    CR Guzzo, RK Salinas, MO Andrade - Journal of molecular , 2009 - Elsevier
     
    7. Cradle-loop barrels and the concept of metafolds in protein classification by natural descent
    V Alva, KK Koretke, M Coles, AN Lupas - Current opinion in structural , 2008 - Elsevier
     
    8. XC1028 from Xanthomonas campestris adopts a PilZ domain_like structure without ac_di_GMP switch
    TN Li, KH Chin, JH Liu, AHJ Wang - Structure, Function, and , 2009 - Wiley Online Library
     
    9. Structural characterization reveals that a PilZ domain protein undergoes substantial conformational change upon binding to cyclic dimeric guanosine monophosphate
    JS Shin, KS Ryu, J Ko, A Lee, BS Choi - Protein Science, 2011 - Wiley Online Library
     
    10. Method of using reduced dimensionality nuclear magnetic resonance spectroscopy for rapid chemical shift assignment and secondary structure determination of
    TA Szyperski - US Patent 7,141,432, 2006 - Google Patents
     
    11. A Novel Tetrameric PilZ Domain Structure from Xanthomonads
    TN Li, KH Chin, KM Fung, MT Yang, AHJ Wang - PloS one, 2011 - dx.plos.org
     
    12. PilZ domain is part of the bacterial c-di-GMP binding protein
    D Amikam, MY Galperin - Bioinformatics, 2006 - Oxford Univ Press
     
    13. Top (Index), File: 18034161. pdf
    C Sensitive, J Benach - The EMBO , 2007 - www-tsujii.is.su-tokyo.ac.jp
     
    14. XC6012 from Xanthomonas campestris Adopts a Novel Tetrameric PilZ Domain Structure Stabilized by a Central Parallel Four-Stranded Coiled-Coil
    TN Li, KH Chin, HJW Andrew - __________, 2009 - research.nchu.edu.tw
     
    15. Sensing the messenger: The diverse ways that bacteria signal through c_di_GMP
    PV Krasteva, KM Giglio, H Sondermann - Protein Science, 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch