.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ylo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of hypothetical protein from Shigella flexneri 2a. To be Published
    Site MCSG
    PDB Id 1ylo Target Id APC27836
    Molecular Characteristics
    Source Shigella flexneri 2a str. 2457t
    Alias Ids TPS5391,AAP17770, 198215 Molecular Weight 37435.86 Da.
    Residues 345 Isoelectric Point 5.18
    Sequence mdlsllkalseadaiasseqevrqilleeaarlqkevrfdglgsvlirlnestgpkvmicahmdevgfm vrsisregaidvlpvgnvrmaarqlqpvrittreeckipglldgdrqgndvsamrvdigartydevmqa girpgdrvtfdttfqvlphqrvmgkafddrlscyllvtllrelhdaelpaevwlvassseevglrggqt atravspdvaivldtacwaknfdygaanhrqigngpmlvlsdksliappkltawietvaaeigvplqad mfsnggtdggavhltgtgvptlvmgpatrhghcaasiadcrdilqmeqllsaliqrltretvvqltdfr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.15 Rfree 0.22893
    Matthews' coefficent 3.25 Rfactor 0.19035
    Waters 677 Solvent Content 62.20

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 12

    Jmol

     
    Google Scholar output for 1ylo
    1. FLORA: a novel method to predict protein function from structure in diverse superfamilies
    OC Redfern, BH Dessailly, TJ Dallman - PLoS computational , 2009 - dx.plos.org
     
    2. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    3. FRalanyzer: a tool for functional analysis of fold-recognition sequencestructure alignments
    HK Saini, D Fischer - Nucleic acids research, 2007 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch