.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ylq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Hypothetical protein AF0614, putative nucleotidyltransferase. To be Published
    Site MCSG
    PDB Id 1ylq Target Id APC5568
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS4697,AAB90629, 224325 Molecular Weight 11147.36 Da.
    Residues 93 Isoelectric Point 8.80
    Sequence mkeikeitkkdvqdaeiylygsvvegdysiglsdidvaivsdvfedrnrkleffgkitkkffdspfefh iltkkewkmskrfirkyrrldlit
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.02 Rfree 0.26746
    Matthews' coefficent 2.30 Rfactor 0.2166
    Waters 126 Solvent Content 46.70

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1ylq
    1. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch