.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ylx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of APC35702, a hypothetical protein from Bacillus stearothermophilus. To be Published
    Site MCSG
    PDB Id 1ylx Target Id APC35702
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5504,RBSTP0844, 1422 Molecular Weight 11724.67 Da.
    Residues 100 Isoelectric Point 4.69
    Sequence mefaprsvvieefidtlepmmeaygldqvgifeehgegnryyvgytinkddemitihmpfvknergela lekqewtvrkdgrekkgfhslqeameevihs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.247
    Matthews' coefficent 2.08 Rfactor 0.229
    Waters 89 Solvent Content 38.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ylx
    1. Static and dynamic characteristics of protein contact networks
    S Khor - Arxiv preprint arXiv:1011.2222, 2010 - arxiv.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch