.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yqg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structures of Delta(1)-Pyrroline-5-carboxylate Reductase from Human Pathogens Neisseria meningitides and Streptococcus pyogenes. J.Mol.Biol. 354 91-106 2005
    Site MCSG
    PDB Id 1yqg Target Id APC28591
    Related PDB Ids 2ag8 
    Molecular Characteristics
    Source Neisseria meningitidis mc58
    Alias Ids TPS5413,AAF40524, 122586 Molecular Weight 28339.83 Da.
    Residues 263 Isoelectric Point 6.92
    Sequence mnvyflgggnmaaavagglvkqggyriyianrgaekrerlekelgvetsatlpelhsddvlilavkpqd meaacknirtngalvlsvaaglsvgtlsrylggtrrivrvmpntpgkiglgvsgmyaeaevsetdrria drimksvgltvwlddeekmhgitgisgsgpayvfylldalqnaairqgfdmaearalslatfkgavala eqtgedfeklqknvtskggttheaveafrrhrvaeaisegvcacvrrsqemerqyq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.24059
    Matthews' coefficent 2.60 Rfactor 0.19495
    Waters 248 Solvent Content 51.90

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1yqg
    1. Structural biology of proline catabolism
    JJ Tanner - Amino acids, 2008 - Springer
     
    2. Crystal Structures of _ 1-Pyrroline-5-carboxylate Reductase from Human Pathogens Neisseria meningitides and Streptococcus pyogenes
    B Nocek, C Chang, H Li, L Lezondra, D Holzle - Journal of molecular , 2005 - Elsevier
     
    3. Crystal structure of human pyrroline-5-carboxylate reductase
    Z Meng, Z Lou, Z Liu, M Li, X Zhao, M Bartlam - Journal of molecular , 2006 - Elsevier
     
    4. The sequence TGAAKAVALVL from glyceraldehyde_3_phosphate dehydrogenase displays structural ambivalence and interconverts between __helical and __hairpin
    S Patel, PV Balaji, YU Sasidhar - Journal of Peptide Science, 2007 - Wiley Online Library
     
    5. The Yeast Ubr1 Ubiquitin Ligase Participates in a Prominent Pathway That Targets Cytosolic Thermosensitive Mutants for Degradation
    F Khosrow-Khavar, NN Fang, AHM Ng - G3: Genes| Genomes| , 2012 - g3journal.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch