.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yqh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Stucture of domain of unknown function DUF77 from Bacillus cereus. To be Published
    Site MCSG
    PDB Id 1yqh Target Id APC22703
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5229,AAP07464, 226900 Molecular Weight 11794.85 Da.
    Residues 106 Isoelectric Point 4.82
    Sequence msqqvtmsfsvvpqaktkdvysvvdkaievvqqsgvryevgamettlegeldvlldvvkraqqacvdag aeevitsikihyrpstgvtidekvwkyrdeyakpeai
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.20062
    Matthews' coefficent 1.90 Rfactor 0.16204
    Waters 292 Solvent Content 35.90

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yqh
    1. Molecular modeling of the bifunctional enzyme UDP-GlcNAc 2-epimerase/ManNAc kinase and predictions of structural effects of mutations associated with HIBM and
    N Kurochkina, T Yardeni, M Huizing - Glycobiology, 2010 - Soc Glycobiology
     
    2. Applications of Bioinformatics to Protein Structures: How Protein Structure and Bioinformatics Overlap
    GW Han, C Rife, MR Sawaya - Methods in Molecular Biology, 2009 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch