.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ysq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural study of effector binding specificity in IclR transcriptional regulators. To be Published
    Site MCSG
    PDB Id 1ysq Target Id APC28251
    Molecular Characteristics
    Source Shigella flexneri 2a str. 2457t
    Alias Ids TPS5402,AAP19123, 198215 Molecular Weight 21043.84 Da.
    Residues 189 Isoelectric Point 5.68
    Sequence alsslniihiaaphlealniatgetinfssreddhailiyklepttgmlrtrayigqhmplycsamgki ymafghpdyvksywenhqheiqpltrntitelpamfdelahiresgaamdreenelgvsciavpvfdih grvpyavsislstsrlkqvgeknllkplretaqaisnelgftvrddlgait
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.20748
    Matthews' coefficent 2.80 Rfactor 0.19396
    Waters 122 Solvent Content 55.00

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 3
    Metals

    Jmol

     
    Google Scholar output for 1ysq
    1. Members of the IclR family of bacterial transcriptional regulators function as activators and/or repressors
    AJ Molina_Henares, T Krell - FEMS microbiology , 2006 - Wiley Online Library
     
    2. Glyoxylate and pyruvate are antagonistic effectors of the Escherichia coli IclR transcriptional regulator
    GL Lorca, A Ezersky, VV Lunin, JR Walker - Journal of Biological , 2007 - ASBMB
     
    3. The IclR family of transcriptional activators and repressors can be defined by a single profile
    T Krell, AJ Molina_Henares, JL Ramos - Protein science, 2006 - Wiley Online Library
     
    4. Structural and biochemical study of effector molecule recognition by the E. coli glyoxylate and allantoin utilization regulatory protein AllR
    JR Walker, S Altamentova, A Ezersky, G Lorca - Journal of molecular , 2006 - Elsevier
     
    5. Structural and functional characterization of IclR transcription regulators
    A Ezersky - 2009 - 142.150.190.46
     
    6. Bases moleculares de la tolerancia a disolventes orgnicos: estudio de la regulacin de la bomba de expulsin de disolventes TtgGHI en Pseudomonas
    ME Guazzaroni - 2007 - 0-hera.ugr.es.adrastea.ugr.es
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch