.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ywq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a nitroreductase family protein from Bacillus cereus ATCC 14579. To be Published
    Site MCSG
    PDB Id 1ywq Target Id APC24701
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5305,AAP08818, 226900 Molecular Weight 22821.87 Da.
    Residues 200 Isoelectric Point 5.42
    Sequence msatttnlkeaivnrrsirkvtkndaitkerieevlktalhaptsfnmqsgrmvvlmdgehekfwdivk etlrarvpaenfeatverlkgfhagvgtvlffedqatvekmqenaplykdqfpfwshqgnamlqhtvwm llsaegigaslqhynpivdaevketwnipaewslvgqmpfgepneqpaertflptedvvkfy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.242
    Matthews' coefficent 3.77 Rfactor 0.205
    Waters 72 Solvent Content 66.11

    Ligand Information
    Ligands FMN (FLAVIN) x 1
    Metals

    Jmol

     
    Google Scholar output for 1ywq
    1. Novel identification of expressed genes and functional classification of hypothetical proteins from Neisseria meningitidis serogroup A
    G Bernardini, S Arena, D Braconi, A Scaloni - , 2007 - Wiley Online Library
     
    2. Structure and function of CinD (YtjD) of Lactococcus lactis, a copper-induced nitroreductase involved in defense against oxidative stress
    M Mermod, F Mourlane, S Waltersperger - Journal of , 2010 - Am Soc Microbiol
     
    3. Crystallization and preliminary X-ray diffraction analysis of ydjA, a minimal nitroreductase from Escherichia coli K12
    JW Choi, J Lee, N Kosuke, CH Jung - Section F: Structural , 2007 - scripts.iucr.org
     
    4. Taiwanofungus camphorata nitroreductase: cDNA cloning and biochemical characterization
    CC Chen, CF Ken, L Wen, CF Chang, CT Lin - Food Chemistry, 2012 - Elsevier
     
    5. Kinetics and thermodynamics of gas diffusion in a NiFe hydrogenase
    J Topin, M Rousset, S Antonczak - Proteins: Structure, , 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch