.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yx1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of hypothetical protein PA2260 from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 1yx1 Target Id APC5559
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4691,NP_250950, 208964 Molecular Weight 28978.44 Da.
    Residues 260 Isoelectric Point 5.74
    Sequence mslhpvsislssygadlvrsrgqasflpllamagaqrvelreelfagppdtealtaaiqlqglecvfss plelwredgqlnpeleptlrraeacgagwlkvslgllpeqpdlaalgrrlarhglqllvendqtpqggr ievlerffrlaerqqldlamtfdignwrwqeqaadeaalrlgryvgyvhckavirnrdgklvavppsaa dlqywqrllqhfpegvaraieyplqgddllslsrrhiaalarlgqpqeerqhg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.80 Rfree 0.2019
    Matthews' coefficent 2.70 Rfactor 0.16947
    Waters 681 Solvent Content 53.30

    Ligand Information
    Ligands IPA (ISOPROPYL) x 3
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 1yx1
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch