.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yxy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The 1.6 A crystal structure of putative N-acetylmannosamine-6-P epimerase from Streptococcus pyogenes. To be Published
    Site MCSG
    PDB Id 1yxy Target Id APC29713
    Molecular Characteristics
    Source Streptococcus pyogenes m1 gas
    Alias Ids TPS5474,AAK33327, 160490 Molecular Weight 25064.61 Da.
    Residues 234 Isoelectric Point 5.11
    Sequence mpdkptkeklmeqlkggiivscqalpgeplysetggimplmakaaqeagavgiransvrdikeiqaitd lpiigiikkdyppqepfitatmtevdqlaalniaviamdctkrdrhdgldiasfirqvkekypnqllma distfdeglvahqagidfvgttlsgytpysrqeagpdvaliealckagiaviaegkihspeeakkindl gvagivvggaitrpkeiaerfiealks
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.20717
    Matthews' coefficent 2.69 Rfactor 0.19337
    Waters 679 Solvent Content 53.86

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yxy
    1. Amino acid pairing at the N_and C_termini of helical segments in proteins
    NA Fonseca, R Camacho - : Structure, Function, and , 2008 - Wiley Online Library
     
    2. Investigating diproline segments in proteins: Occurrences, conformation and classification
    I Saha, N Shamala - Biopolymers, 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch