.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yyv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of putative transcriptional regulator ytfH from Salmonella typhimurium. To be Published
    Site MCSG
    PDB Id 1yyv Target Id APC24195
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS5289,NP_463263, 99287 Molecular Weight 14386.75 Da.
    Residues 128 Isoelectric Point 7.97
    Sequence mrahtlsrqlregnlfaeqcpsrevlkhvtsrwgvlilvalrdgthrfsdlrrkmggvsekmlaqslqa leqdgflnrvsypvvpphveysltplgeqvsdkvaaladwielnlpqvlaqrerlsdgg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.35 Rfree 0.2439
    Matthews' coefficent 2.80 Rfactor 0.201
    Waters 74 Solvent Content 56.00

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 1yyv
    1. Structure of the transcriptional regulator LmrR and its mechanism of multidrug recognition
    PK Madoori, H Agustiandari, AJM Driessen - The EMBO , 2008 - nature.com
     
    2. Top (Index), File: 19096365. pdf
    C Sensitive, PK Madoori - The EMBO , 2009 - www-tsujii.is.su-tokyo.ac.jp
     
    3. Homology modeling, docking studies and functional analysis of various azoreductase accessory interacting proteins of Nostoc sp. PCC7120
    PD Philem, S Adhikari - Bioinformation, 2012 - ncbi.nlm.nih.gov
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch