.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yzf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the lipase/acylhydrolase from Enterococcus faecalis. To be Published
    Site MCSG
    PDB Id 1yzf Target Id APC28731
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5416,AAO80043, 226185 Molecular Weight 21468.62 Da.
    Residues 195 Isoelectric Point 5.08
    Sequence mrkivlfgdsitagyldeavspvlvdlvkrdiaamgleevavinagmpgdttedglkrlnkevliekpd evviffgandasldrnitvatfrenletmiheigsekvilitppyadsgrrperpqtrikelvkvaqev gaahnlpvidlykamtvypgtdeflqadglhfsqvgyellgalivreikgrlkpkqa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.23901
    Matthews' coefficent 2.01 Rfactor 0.18355
    Waters 263 Solvent Content 36.55

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yzf
    1. Novel eukaryotic enzymes modifying cell-surface biopolymers
    V Anantharaman, L Aravind - Biol Direct, 2010 - biomedcentral.com
     
    2. Crystal Structure of a Cellulosomal Family 3 Carbohydrate Esterase from Clostridium thermocellum Provides Insights into the Mechanism of Substrate
    MAS Correia, JAM Prates, J Brs, CMGA Fontes - Journal of molecular , 2008 - Elsevier
     
    3. Expression, purification, crystallization and preliminary X-ray analysis of Pseudomonas aeruginosa AlgX
    JT Weadge, PP Yip, H Robinson, K Arnett - Section F: Structural , 2010 - scripts.iucr.org
     
    4. Characterization, amyloid formation, and immobilization of a novel SGNH hydrolase from Listeria innocua 11262
    S Kim, SY Bae, SJ Kim, TD Ngo, KK Kim - International Journal of , 2011 - Elsevier
     
    5. Crystal structure of isoamyl acetate_hydrolyzing esterase from Saccharomyces cerevisiae reveals a novel active site architecture and the basis of substrate specificity
    J Ma, Q Lu, Y Yuan, H Ge, K Li, W Zhao - Proteins: Structure, , 2011 - Wiley Online Library
     
    6. Arab-1, a GDSL lipase from the model plant, Arabidopsis thaliana (L.) Heynh.
    G Mikleuevi_, B Salopek-Sondi, M Lui_ - Croatica chemica acta, 2009 - hrcak.srce.hr
     
    7. Multifunctionality and diversity of GDSL esterase/lipase gene family in rice (Oryza sativa L. japonica) genome: new insights from bioinformatics analysis
    H Chepyshko, CP Lai, LM Huang, JH Liu - BMC , 2012 - biomedcentral.com
     
    8. Structural and functional insights into the role of Carbohydrate Esterases and Carbohydrate-Binding Modules in plant cell wall hydrolysis
    MAS Correia - 2009 - repository.utl.pt
     
    9. Prdiction des rsidus impliqus dans le noyau du repliement et classification structurale de fragments protiques en interaction.
    N Prudhomme - 2009 - hal.archives-ouvertes.fr
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch