.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yzh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Conserved Methyltransferase from Streptococcus pneumoniae TIGR4. To be Published
    Site MCSG
    PDB Id 1yzh Target Id APC80283
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5592,AAK74707, 170187 Molecular Weight 24377.44 Da.
    Residues 211 Isoelectric Point 5.87
    Sequence mrvrnrkgatelleanpqyvvlnpleakakwrdlfgndnpihvevgsgkgafvsgmakqnpdinyigid iqksvlsyaldkvlevgvpnikllwvdgsdltdyfedgeidrlylnfsdpwpkkrhekrrltyktfldt fkrilpengeihfktdnrglfeyslvsfsqygmklngvwldlhasdfegnvmteyeqkfsnkgqviyrv eaef
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.02 Rfree 0.20798
    Matthews' coefficent 2.70 Rfactor 0.17901
    Waters 344 Solvent Content 54.00

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 1yzh
    1. Crystal structure of Bacillus subtilis TrmB, the tRNA (m7G46) methyltransferase
    I Zegers, D Gigot, F Van Vliet, C Tricot - Nucleic acids , 2006 - Oxford Univ Press
     
    2. The targets of CAPRI rounds 1319
    J Janin - Proteins: Structure, Function, and Bioinformatics, 2010 - Wiley Online Library
     
    3. Crystallization and preliminary crystallographic analysis of tRNA (m7G46) methyltransferase from Escherichia coli
    Q Liu, Y Gao, W Yang, H Zhou, X Zhang - Section F: Structural , 2008 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch