.
The Open Protein Structure Annotation Network
PDB Keyword
.

1z05

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the ROK family transcriptional regulator, homolog of E.coli MLC protein. To be Published
    Site MCSG
    PDB Id 1z05 Target Id APC26690
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar eltor str. n16961
    Alias Ids TPS5365,AAF95155, 243277 Molecular Weight 44290.52 Da.
    Residues 405 Isoelectric Point 5.52
    Sequence mymaqpghidhikqinagrvyklidqkgpisridlskeselapasitkitrelidahlihettvqeais rgrpavglqtnnlgwqflsmrlgrgyltialhelggevlidtkidiheidqddvlarllfeieeffqty aaqldrvtsiaitlpglvnseqgivlqmphynvknlalgpeiykatglpvfvandtrawalaeklfghs qdvdnsvlisihhglgagivldgrvlqgrhgnigelghiqidpqgkrchcgnygcletvassqairdqv tariqagepsclatveeisiedicaaaadgdplavdviqqlgrylgaaiaivinlfnpekiliggvinq aksilypsieqcireqslpvyhqdlklvesrfykqatmpgaalikqalydglllmkvveg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.22429
    Matthews' coefficent 3.00 Rfactor 0.18501
    Waters 411 Solvent Content 58.00

    Ligand Information
    Ligands SO4 (SULFATE) x 6;BME (BETA-MERCAPTOETHANOL) x 1;GOL (GLYCEROL) x 1
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 1z05
    1. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    2. Fido, a novel AMPylation domain common to fic, doc, and AvrB
    LN Kinch, ML Yarbrough, K Orth, NV Grishin - PLoS One, 2009 - dx.plos.org
     
    3. The crystal structure of Mlc, a global regulator of sugar metabolism in Escherichia coli
    A Schiefner, K Gerber, S Seitz, W Welte - Journal of Biological , 2005 - ASBMB
     
    4. The transcriptional regulator Rv0485 modulates the expression of a pe and ppe gene pair and is required for Mycobacterium tuberculosis virulence
    RM Goldstone, SD Goonesekera, BR Bloom - Infection and , 2009 - Am Soc Microbiol
     
    5. Crystal structure of the N-acetylmannosamine kinase domain of GNE
    Y Tong, W Tempel, L Nedyalkova, F MacKenzie - PloS one, 2009 - dx.plos.org
     
    6. The linker sequence, joining the DNA_binding domain of the homologous transcription factors, Mlc and NagC, to the rest of the protein, determines the specificity of
    D Brchemier_Baey - Molecular , 2012 - Wiley Online Library
     
    7. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch