.
The Open Protein Structure Annotation Network
PDB Keyword
.

1z0p

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The 1.7A Crystal structure of the hypothetical protein SPy1572 from Streptococcus pyogenes. To be Published
    Site MCSG
    PDB Id 1z0p Target Id APC80038
    Molecular Characteristics
    Source Streptococcus pyogenes m1 gas
    Alias Ids TPS5578,AAK34359, 160490 Molecular Weight 9934.51 Da.
    Residues 84 Isoelectric Point 4.68
    Sequence msyekeflkdfedwvktqiqvnqlamatsqevaqedgderakdafiryeskldayefllgkfdnykngk afhdipdelfgarhy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.256
    Matthews' coefficent 1.89 Rfactor 0.22
    Waters 66 Solvent Content 32.23

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch