.
The Open Protein Structure Annotation Network
PDB Keyword
.

1z0x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of transcriptional regulator, tetR Family from Enterococcus faecalis V583. To be Published
    Site MCSG
    PDB Id 1z0x Target Id APC28890
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5423,AAO80602, 226185 Molecular Weight 25251.68 Da.
    Residues 220 Isoelectric Point 5.24
    Sequence mepklskdtiiaaafslleksptleqlsmrkvakqlgvqapaiywyfknkqallqsmaeaieehfqepa lcgewysdllafmenyydlyqqfpcavaieiqtvpaypqrlrhlnqmmgilreagfspemthlavtslq hllfgmimdateekqlvsqvlngddylkeqvlhmkqyvsdneltymeesiqfrhsihqksafiqavkty ldglqadntsssk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.283
    Matthews' coefficent 2.10 Rfactor 0.219
    Waters 165 Solvent Content 41.90

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 1z0x
    1. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    2. A comprehensive analysis of structural and sequence conservation in the TetR family transcriptional regulators
    Z Yu, SE Reichheld, A Savchenko, J Parkinson - Journal of molecular , 2010 - Elsevier
     
    3. Expression, crystallization and X-ray data collection from microcrystals of the extracellular domain of the human inhibitory receptor expressed on myeloid cells IREM-1
    N Dimasi, D Flot, F Dupeux - Crystallographica Section F , 2007 - scripts.iucr.org
     
    4. New insights into the structure, function and evolution of TETR family transcriptional regulators
    Z Yu - 2010 - 142.150.190.46
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch