.
The Open Protein Structure Annotation Network
PDB Keyword
.

1z67

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of YidB protein from Shigella flexneri shows a new fold with homeodomain motif. Proteins 65 509-513 2006
    Site MCSG
    PDB Id 1z67 Target Id APC28208
    Molecular Characteristics
    Source Shigella flexneri 2a str. 2457t
    Alias Ids TPS5399,AAP18988, 198215 Molecular Weight 13858.91 Da.
    Residues 132 Isoelectric Point 4.49
    Sequence mglfdevvgaflkgdagkyqailswveeqggiqvlleklqsgglgailstwlsnqqrnqsvsgeqlesa lgtnavsdlgqklgvdtstassllaeqlpkiidalspqgevsaqanndllsagmellkgklfr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.45 Rfree 0.2079
    Matthews' coefficent 2.00 Rfactor 0.1617
    Waters 156 Solvent Content 37.50

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 1z67
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Structure of YidB protein from Shigella flexneri shows a new fold with homeodomain motif
    J Osipiuk, N Maltseva, I Dementieva - Proteins: Structure, , 2006 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch