.
The Open Protein Structure Annotation Network
PDB Keyword
.

1z6m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a conserved hypothetical protein from Enterococcus faecalis V583. To be Published
    Site MCSG
    PDB Id 1z6m Target Id APC28886
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5422,AAO80587, 226185 Molecular Weight 19508.13 Da.
    Residues 172 Isoelectric Point 4.86
    Sequence mdisvidatkvntetglhigesnapvkmiefinvrcpycrkwfeeseellaqsvksgkveriiklfdke keslqrgnvmhhyidysapeqalsalhkmfatqdewgnltleevatyaeknlglkeqkdatlvsaviae anaahiqfvptiiigeyifdesvteeelrgyiek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.30 Rfree 0.18688
    Matthews' coefficent 1.99 Rfactor 0.15537
    Waters 265 Solvent Content 38.29

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1z6m
    1. Structural and functional characterization of the oxidoreductase _-DsbA1 from Wolbachia pipientis
    M Kurz, I Iturbe-Ormaetxe, R Jarrott - & redox signaling, 2009 - online.liebertpub.com
     
    2. Remote thioredoxin recognition using evolutionary conservation and structural dynamics
    GW Tang, RB Altman - Structure, 2011 - Elsevier
     
    3. A novel structural motif and structural trees for proteins containing it
    AM Kargatov, AV Efimov - Biochemistry (Moscow), 2010 - Springer
     
    4. Disulfide conformation and design at helix N_termini
    S Indu, ST Kumar, S Thakurela, M Gupta - Proteins: Structure, , 2010 - Wiley Online Library
     
    5. Refinement of protein termini in template_based modeling using conformational space annealing
    H Park, J Ko, K Joo, J Lee, C Seok - : Structure, Function, and , 2011 - Wiley Online Library
     
    6. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch