.
The Open Protein Structure Annotation Network
PDB Keyword
.

1z72

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a putative transcriptional regulator from Streptococcus pneumoniae. To be Published
    Site MCSG
    PDB Id 1z72 Target Id APC80324
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5595,AAK74857, 170187 Molecular Weight 25613.81 Da.
    Residues 222 Isoelectric Point 4.78
    Sequence metqdyafqpgltvgellkssqkdwqaainhrfvkelfagtienkvlkdyliqdyhffdaflsmlgacv ahadklesklrfakqlgfleadedgyfqkafkelkvaendylevtlhpvtkafqdlmysavassdyahl lvmlviaeglyldwgskdlalpevyihsewinlhrgpffaewvqflvdelnrvgknredltelqqrwnq avalelaffdigydv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.45 Rfree 0.16709
    Matthews' coefficent 3.20 Rfactor 0.15119
    Waters 745 Solvent Content 61.40

    Ligand Information
    Ligands ACY (ACETIC) x 3
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 1z72
    1. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch