.
The Open Protein Structure Annotation Network
PDB Keyword
.

1z7u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Putitive Transcriptional Regulator of MarR Family from Enterococcus faecalis. To be Published
    Site MCSG
    PDB Id 1z7u Target Id APC28846
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5421,AAO80472, 226185 Molecular Weight 12531.68 Da.
    Residues 109 Isoelectric Point 7.87
    Sequence mttdkqtsinlalstingkwklslmdelfqgtkrngelmraldgitqrvltdrlremekdglvhresfn elpprveytltpegyalydalsslchwgetfaqkkarlnk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.26126
    Matthews' coefficent 3.20 Rfactor 0.20465
    Waters 195 Solvent Content 61.50

    Ligand Information
    Ligands FMT (FORMIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 1z7u
    1. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    2. The crystal structure of XC1739: A putative multiple antibiotic_resistance repressor (MarR) from Xanthomonas campestris at 1.8 resolution
    KH Chin, ZL Tu, JN Li, CC Chou - PROTEINS: , 2006 - Wiley Online Library
     
    3. Discriminative random field approach to prediction of protein residue contacts
    M Kamada, M Hayashida, J Song - Systems Biology (ISB), , 2011 - ieeexplore.ieee.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch