.
The Open Protein Structure Annotation Network
PDB Keyword
.

1z9u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the acetyl transferase, modifies N-terminal serine of 50S ribosomal subunit protein L7/L12 from Salmonella typhimurium. TO BE PUBLISHED
    Site MCSG
    PDB Id 1z9u Target Id APC24460
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS5297,NP_460570, 99287 Molecular Weight 20604.48 Da.
    Residues 179 Isoelectric Point 6.65
    Sequence mveiipvsttlelraadeshvpalhqlvlknkawlqqsldwpqyvtsqeetrkhvqgnillhqrgyakm ylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqalmthyarrgdirrfvikcrvdn qasnavarrnhftlegcmkqaeylngdyhdvnmyariidad
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.25673
    Matthews' coefficent 2.19 Rfactor 0.21706
    Waters 249 Solvent Content 41.58

    Ligand Information
    Ligands SO4 (SULFATE) x 8
    Metals

    Jmol

     
    Google Scholar output for 1z9u
    1. His-tag impact on structure
    M Carson, DH Johnson, H McDonald - Section D: Biological , 2007 - scripts.iucr.org
     
    2. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch