.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zk8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure Of TetR repressor from Bacillus cereus ATCC14579. To be Published
    Site MCSG
    PDB Id 1zk8 Target Id APC26195
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5345,AAP11872, 226900 Molecular Weight 20190.13 Da.
    Residues 183 Isoelectric Point 6.17
    Sequence mmsprigltlqkivetaaeiadangvqevtlaslaqtlgvrspslynhvkglqdvrknlgiygikklhn rleeaaedkrmdeaihalgeayvafvrkhpglyeatflrdeevrkagdgivklclqvlqqyglegenal hatrgfrsichgfasieqqggfglpldldislhvlletfikglre
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.15 Rfree 0.23858
    Matthews' coefficent 2.10 Rfactor 0.18174
    Waters 210 Solvent Content 49.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1zk8
    1. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    2. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    3. Crystal structure of the Vibrio cholerae quorum-sensing regulatory protein HapR
    RS De Silva, G Kovacikova, W Lin, RK Taylor - Journal of , 2007 - Am Soc Microbiol
     
    4. Solution structure of the Arabidopsis thaliana telomeric repeat-binding protein DNA binding domain: a new fold with an additional C-terminal helix
    SC Sue, H Hsiao, BCP Chung, YH Cheng - Journal of molecular , 2006 - Elsevier
     
    5. A comprehensive analysis of structural and sequence conservation in the TetR family transcriptional regulators
    Z Yu, SE Reichheld, A Savchenko, J Parkinson - Journal of molecular , 2010 - Elsevier
     
    6. Automatic structure classification of small proteins using random forest
    P Jain, J Hirst - BMC bioinformatics, 2010 - biomedcentral.com
     
    7. Crystal structure of TM1030 from Thermotoga maritima at 2.3 resolution reveals molecular details of its transcription repressor function
    L Premkumar, CL Rife, S Sri Krishna - Proteins: Structure, , 2007 - Wiley Online Library
     
    8. New insights into the structure, function and evolution of TETR family transcriptional regulators
    Z Yu - 2010 - 142.150.190.46
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch