.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zkp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.5A Resolution Crystal Structure of a Metallo Beta Lactamase FamilyProtein, the ELAC Homolgue of Bacillus anthracis, a Putative Ribonuclease. To be Published
    Site MCSG
    PDB Id 1zkp Target Id APC28677
    Molecular Characteristics
    Source Bacillus anthracis str. ames
    Alias Ids TPS5415,NP_843581, 198094 Molecular Weight 26772.84 Da.
    Residues 244 Isoelectric Point 5.46
    Sequence mkmtvvgfwggfpeageatsgylfehdgfrllvdcgsgvlaqlqkyitpsdidavvlshyhhdhvadig vlqyarlitsatkgqlpelpiyghtfdengfhslthephtkgipynpeetlqigpfsisflktvhpvtc famritagndivvysadssyipefipftkdadlficecnmyahqeaakaghmnstevasiakdanvkel llthlphtgnpadlvteakqifsghitlahsgyvwns
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.50 Rfree 0.18009
    Matthews' coefficent 2.00 Rfactor 0.14736
    Waters 1454 Solvent Content 38.30

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 4;ZN (ZINC) x 8;CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 1zkp
    1. Molecular Architecture of the Mn 2+-dependent Lactonase UlaG Reveals an RNase-like Metallo-_-lactamase Fold and a Novel Quaternary Structure
    F Garces, FJ Fernndez, C Montell - Journal of molecular , 2010 - Elsevier
     
    2. BrabA. 11339. a: anomalous diffraction and ligand binding guide towards the elucidation of the function of aputative-lactamase-like protein'from Brucella melitensis
    J Abendroth, B Sankaran, TE Edwards - Section F: Structural , 2011 - scripts.iucr.org
     
    3. The UlaG protein family defines novel structural and functional motifs grafted on an ancient RNase fold
    FJ Fernandez, F Garces, M Lopez-Estepa - BMC evolutionary , 2011 - biomedcentral.com
     
    4. Mn2+_Dependent L_Ascorbate 6_Phosphate Lactonase
    FJ Fernandez, MC Vega - Encyclopedia of Inorganic and , 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch