.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zma

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of the Bacterocin Transport Accessory Protein from Streptococcus pneumoniae. To be Published
    Site MCSG
    PDB Id 1zma Target Id APC80531
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5610,AAK75590, 170187 Molecular Weight 12865.93 Da.
    Residues 115 Isoelectric Point 5.64
    Sequence meqfldnikdlevttvvraqealdkketatffigrktcpycrkfagtlsgvvaetkahiyfinseepsq lndlqafrsrygiptvpgfvhitdgqinvrcdssmsaqeikdfagl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.25 Rfree 0.16686
    Matthews' coefficent 2.00 Rfactor 0.12748
    Waters 253 Solvent Content 37.00

    Ligand Information
    Ligands FMT (FORMIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 1zma
    1. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    2. A novel structural motif and structural trees for proteins containing it
    AM Kargatov, AV Efimov - Biochemistry (Moscow), 2010 - Springer
     
    3. Disulfide conformation and design at helix N_termini
    S Indu, ST Kumar, S Thakurela, M Gupta - Proteins: Structure, , 2010 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch