.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zox

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Mouse CLM-1 Ectodomain. To be Published
    Site MCSG
    PDB Id 1zox Target Id APC35384
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS5492,AAR27938, 10090 Molecular Weight 36712.81 Da.
    Residues 337 Isoelectric Point 5.17
    Sequence mhlsllvpflfwitgcctaedpvtgpeevsgqeqgsltvqcrytsgwkdykkywcqgvpqrscktlvet daseqlvkknrvsirdnqrdfiftvtmedlrmsdagiywcgitkggldpmfkvtvnigpaiqvpitvpt mppitstttiftvtttvketsmfptltsyysdnghgggdsgggedgvgdgfldlsvllpvisavlllll lvaslfawrmvrrqkkaagppseqaqslegdlcyadlslkqprtspgsswkkgssmsssgkdhqeevey vtmapfpreevsyaaltlaglgqeptygntgcpithvprtgleeetteyssirrplpaamp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.251
    Matthews' coefficent 2.06 Rfactor 0.204
    Waters 132 Solvent Content 35.40

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1zox
    1. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    2. The structure of the extracellular domain of triggering receptor expressed on myeloid cells like transcript-1 and evidence for a naturally occurring soluble fragment
    JL Gattis, AV Washington, MM Chisholm - Journal of Biological , 2006 - ASBMB
     
    3. The crystal structure of the extracellular domain of the inhibitor receptor expressed on myeloid cells IREM-1
    JA Mrquez, E Galfr, F Dupeux, D Flot - Journal of molecular , 2007 - Elsevier
     
    4. Comparative analysis of NK-cell receptor expression and function across primate species: Perspective on antiviral defenses
    R Biassoni, E Ugolotti, A De Maria - Self Nonself, 2010 - ncbi.nlm.nih.gov
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch