.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zs7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of gene product APE0525 from Aeropyrum pernix. To be Published
    Site MCSG
    PDB Id 1zs7 Target Id APC5571
    Molecular Characteristics
    Source Aeropyrum pernix k1
    Alias Ids TPS4699,BAA79490.1, 272557 Molecular Weight 20732.08 Da.
    Residues 186 Isoelectric Point 9.62
    Sequence mlwarlvglarlearalskkerrsllerlkpyytripfsekadlrlvkartdsgeyeiitvdgvpclfe wsdgriyptlqclkafgvdwlkgvvlvdkgaaialakgahlmipgvvgvegsftrgdvvaalyhetrtp vmvgvaevdssaleklyrekargravrrvhrlgdalwelaqevgkrls
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.19883
    Matthews' coefficent 2.60 Rfactor 0.16668
    Waters 246 Solvent Content 52.20

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 5
    Metals K (POTASSIUM) x 1

    Jmol

     
    Google Scholar output for 1zs7
    1. Muscarinic receptors: a comparative analysis of structural features and binding modes through homology modelling and molecular docking
    A Pedretti, G Vistoli, C Marconi - Chemistry & , 2006 - Wiley Online Library
     
    2. Structure and dynamics of the full-length M 1 muscarinic acetylcholine receptor studied by molecular dynamics simulations
    LM Espinoza-Fonseca, A Pedretti, G Vistoli - Archives of biochemistry and , 2008 - Elsevier
     
    3. Studies on the inference of protein binding regions across fold space based on structural similarities
    J Teyra, J Hawkins, H Zhu - : Structure, Function, and , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch