.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zts

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of protein yqbG from Bacillus subtilis reveals a novel alpha-helical protein fold. Proteins 62 288-291 2006
    Site NESGC
    PDB Id 1zts Target Id SR215
    Related PDB Ids 1xn8 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4544,1.10.3230.10, PF11436, 6366 Molecular Weight 14696.01 Da.
    Residues 131 Isoelectric Point 4.60
    Sequence mllitpdelksysvfesvktrpdellkqdileatadiilkvghdfsdaeyiplpetvrlallklsqfya lingdesiikgyttekigdysytlgdgsplqkpdvyalikdyvkpadpdlegieakvrmrsi
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1zts
    1. The crystal structure of bacteriophage HK97 gp6: defining a large family of head-tail connector proteins
    L Cardarelli, R Lam, A Tuite, LA Baker - Journal of molecular , 2010 - Elsevier
     
    2. The crystal structure of bacteriophage HK97 gp6: defining a large family of head-tail connector proteins
    L Cardarelli, R Lam, A Tuite, LA Baker - Journal of molecular , 2010 - Elsevier
     
    3. NMR structure of protein yqbG from Bacillus subtilis reveals a novel __helical protein fold
    G Liu, Y Shen, R Xiao, T Acton, LC Ma - Proteins: Structure, , 2006 - Wiley Online Library
     
    4. NMR structure of protein yqbG from Bacillus subtilis reveals a novel __helical protein fold
    G Liu, Y Shen, R Xiao, T Acton, LC Ma - Proteins: Structure, , 2006 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch