.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zwy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein VC0702 from Vibrio cholerae. To be Published
    Site MCSG
    PDB Id 1zwy Target Id APC26370
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar eltor str. n16961
    Alias Ids TPS5352,AAF93867, 243277 Molecular Weight 20560.55 Da.
    Residues 183 Isoelectric Point 6.98
    Sequence mppiikrrvmrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeetkqgalnrvr nakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvlerlrqakelgdvmdevfg tenikqkggaiglltrhhltrstvyhqalilalipfinpehypsa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.90 Rfree 0.22552
    Matthews' coefficent 2.50 Rfactor 0.18049
    Waters 567 Solvent Content 50.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1zwy
    1. House cleaning, a part of good housekeeping
    MY Galperin, OV Moroz, KS Wilson - Molecular , 2006 - Wiley Online Library
     
    2. Hot Macromolecular Crystals
    KD Koclega, M Chruszcz, MD Zimmerman - Crystal growth & , 2009 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch