.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zx5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a putative mannosephosphate isomerase from Archaeoglobus fulgidus. To be Published
    Site MCSG
    PDB Id 1zx5 Target Id APC5560
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS4692,NP_068876, 224325 Molecular Weight 33494.34 Da.
    Residues 299 Isoelectric Point 5.30
    Sequence melpsfifqaqenlverpwggewiallkgfrqsgigeswefsahtsrpstvlvkgqqlsmielfskhrd ellgraaekfskfpilvrlidaasptqvhvhpsdkaaeslgeaeggvesawlvfnkgkayagfkedvki eeleeklkeedfdfktllntfettpydtfvirpgiphageglrvlevssnstlayffnendwekvkkvl ntkkveefevkgkkgmaetenfglevvdvtgtaeiktggvmnilyaaegyfilrgketadlhrgysclv pastdsftvesergkivriylkv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.19081
    Matthews' coefficent 4.50 Rfactor 0.16243
    Waters 246 Solvent Content 66.10

    Ligand Information
    Ligands LFR (BETA-L-FRUCTO-FURANOSE) x 1;EDO (1,2-ETHANEDIOL) x 2;ACY (ACETIC) x 6;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 1zx5
    1. The reaction mechanism of type I phosphomannose isomerases: New information from inhibition and polarizable molecular mechanics studies
    C Roux, J Foret, B de Courcy, N Gresh - Proteins: Structure, , 2011 - Wiley Online Library
     
    2. Structures of mannose-6-phosphate isomerase from Salmonella typhimurium bound to metal atoms and substrate: implications for catalytic mechanism
    SR Sagurthi, G Gowda, HS Savithri - Section D: Biological , 2009 - scripts.iucr.org
     
    3. Cloning, expression, purification, crystallization and preliminary X-ray crystallographic analysis of the mannose 6-phosphate isomerase from Salmonella typhimurium
    G Gowda, SR Sagurthi, HS Savithri - Section F: Structural , 2008 - scripts.iucr.org
     
    4. Bacterial Type II PMIs: Exploitable Bifunctional Enzymes for Biotechnological Applications and the Rational Design of Antimicrobials
    SA Sousa, CG Ramos, J Feliciano, JH Leito - 2010 - intechopen.com
     
    5. In-silico evidence of a pAO1 encoded pathway for the catabolism of tagatose derivatives in Arthrobacter nicotinovorans
    M Mih__an - Biologia, 2010 - Springer
     
    6. Assisted assignment of ligands corresponding to unknown electron density
    TA Binkowski, M Cuff, B Nocek, C Chang - Journal of structural and , 2010 - Springer
     
    7. Molecular characterization of a novel thermostable mannose-6-phosphate isomerase from Thermus thermophilus
    SJ Yeom, YS Kim, YR Lim, KW Jeong, JY Lee, Y Kim - Biochimie, 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch