.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a5l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the Trp repressor binding protein WrbA from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 2a5l Target Id APC5760
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4809,AAG04338.1, 208964 Molecular Weight 20761.50 Da.
    Residues 198 Isoelectric Point 6.30
    Sequence msspyilvlyysrhgataemarqiargveqggfearvrtvpavsteceavapdipaegalyatledlkn caglalgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggqettqlsmllpllhhgm lvlgipysepalletrgggtpygashfagadgkrsldeheltlcralgkrlaetagklgs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.19561
    Matthews' coefficent 2.10 Rfactor 0.15808
    Waters 477 Solvent Content 42.00

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 2a5l
    1. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    2. Crystal structure of an apo form of Shigella flexneri ArsH protein with an NADPH_dependent FMN reductase activity
    II Vorontsov, G Minasov, JS Brunzelle - Protein , 2007 - Wiley Online Library
     
    3. Structural organization of WrbA in apo-and holoprotein crystals
    J Wolfova, IK Smatanova, J Brynda, JR Mesters - et Biophysica Acta (BBA , 2009 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch