.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a67

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Isochorismatase family protein. To be Published
    Site MCSG
    PDB Id 2a67 Target Id APC29615
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5468,AAO82771, 226185 Molecular Weight 18997.73 Da.
    Residues 166 Isoelectric Point 6.03
    Sequence mknralllidfqkgiesptqqlyrlpavldkvnqriavyrqhhapiifvqheetelpfgsdswqlfekl dtqptdffirkthanafyqtnlndllteqavqtleiagvqtefcvdttirmahglgytclmtpkttstl dnghltaaqiiqhheaiwagrfltflsl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.2311
    Matthews' coefficent 3.20 Rfactor 0.18978
    Waters 336 Solvent Content 60.70

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2a67
    1. A novel enzyme conferring streptothricin resistance alters the toxicity of streptothricin D from broad-spectrum to bacteria-specific
    Y Hamano, N Matsuura, M Kitamura - Journal of Biological , 2006 - ASBMB
     
    2. High-resolution crystal structures of Streptococcus pneumoniae nicotinamidase with trapped intermediates provide insights into the catalytic mechanism and inhibition
    JB French, Y Cen, AA Sauve, SE Ealick - Biochemistry, 2010 - ACS Publications
     
    3. Crystal structure of a putative isochorismatase hydrolase from Oleispira antarctica
    AM Goral, KL Tkaczuk, M Chruszcz, O Kagan - Journal of Structural and , 2012 - Springer
     
    4. Selective toxicity alteration of a highly toxic antibiotic by an enzyme catalyzing antibiotic modification
    Y Hamano - ________, 2008 - J-STAGE
     
    5. ______ RNA __ __ __
    ____ ___ - 2005 - dbpia.co.kr
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch