.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ae8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Imidazoleglycerol-phosphate Dehydratase from Staphylococcus aureus subsp. aureus N315. To be Published
    Site MCSG
    PDB Id 2ae8 Target Id APC23695
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus n315
    Alias Ids TPS5277,NP_375795, 158879 Molecular Weight 21455.23 Da.
    Residues 192 Isoelectric Point 5.41
    Sequence miyqkqrntaetqlnisisddqspshintgvgflnhmltlftfhsglslnieaqgdidvddhhvtedig ivigqlllemikdkkhfvrygtmyipmdetlarvvvdisgrpylsfnaslskekvgtfdtelveeffra vvinarltthidlirggnthheieaifkafsralgialtatddqrvpsskgvie
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.01 Rfree 0.2263
    Matthews' coefficent 52.60 Rfactor 0.18772
    Waters 946 Solvent Content 2.60

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 16

    Jmol

     
    Google Scholar output for 2ae8
    1. Structural snapshots of Escherichia coli histidinol phosphate phosphatase along the reaction pathway
    ES Rangarajan, A Proteau, J Wagner, MN Hung - Journal of Biological , 2006 - ASBMB
     
    2. Identification of novel bacterial histidine biosynthesis inhibitors using docking, ensemble rescoring, and whole-cell assays
    ST Henriksen, J Liu, G Estiu, ZN Oltvai - Bioorganic & medicinal , 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch