.
The Open Protein Structure Annotation Network
PDB Keyword
.

2aee

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Orotate phosphoribosyltransferase from Streptococcus pyogenes. To be Published
    Site MCSG
    PDB Id 2aee Target Id APC29854
    Molecular Characteristics
    Source Streptococcus pyogenes m1 gas
    Alias Ids TPS5483,AAK33818, 160490 Molecular Weight 22741.95 Da.
    Residues 209 Isoelectric Point 6.43
    Sequence mtlasqiatqlldikavylkpedpftwasgikspiytdnrvtlsypktrdliengfvetikahfpevev iagtatagiphgaiiadkmtlpfayirskpkdhgagnqiegrvlkgqkmviiedlistggsvldaaaaa sregadvlgvvaiftyelpkasqnfkeagiklitlsnyteliavaklqgyitndglhllkkfkedqvnwqq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.22942
    Matthews' coefficent 2.80 Rfactor 0.18932
    Waters 179 Solvent Content 55.20

    Ligand Information
    Ligands SO4 (SULFATE) x 3;GOL (GLYCEROL) x 2
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 2aee
    1. Structure of orotate phosphoribosyltransferase from the caries pathogen Streptococcus mutans
    CP Liu, R Xu, ZQ Gao, JH Xu, HF Hou, LQ Li - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch