.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ag8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structures of Delta(1)-Pyrroline-5-carboxylate Reductase from Human Pathogens Neisseria meningitides and Streptococcus pyogenes. J.Mol.Biol. 354 91-106 2005
    Site MCSG
    PDB Id 2ag8 Target Id APC28591
    Related PDB Ids 1yqg 
    Molecular Characteristics
    Source Neisseria meningitidis mc58
    Alias Ids TPS5412,AAF40524, 122586 Molecular Weight 28339.83 Da.
    Residues 263 Isoelectric Point 6.92
    Sequence mnvyflgggnmaaavagglvkqggyriyianrgaekrerlekelgvetsatlpelhsddvlilavkpqd meaacknirtngalvlsvaaglsvgtlsrylggtrrivrvmpntpgkiglgvsgmyaeaevsetdrria drimksvgltvwlddeekmhgitgisgsgpayvfylldalqnaairqgfdmaearalslatfkgavala eqtgedfeklqknvtskggttheaveafrrhrvaeaisegvcacvrrsqemerqyq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.25244
    Matthews' coefficent 2.60 Rfactor 0.17715
    Waters 241 Solvent Content 51.90

    Ligand Information
    Ligands NAP (NADP) x 1
    Metals

    Jmol

     
    Google Scholar output for 2ag8
    1. Crystal structure of human pyrroline-5-carboxylate reductase
    Z Meng, Z Lou, Z Liu, M Li, X Zhao, M Bartlam - Journal of molecular , 2006 - Elsevier
     
    2. Structural biology of proline catabolism
    JJ Tanner - Amino acids, 2008 - Springer
     
    3. Crystal Structures of _ 1-Pyrroline-5-carboxylate Reductase from Human Pathogens Neisseria meningitides and Streptococcus pyogenes
    B Nocek, C Chang, H Li, L Lezondra, D Holzle - Journal of molecular , 2005 - Elsevier
     
    4. Assisted assignment of ligands corresponding to unknown electron density
    TA Binkowski, M Cuff, B Nocek, C Chang - Journal of structural and , 2010 - Springer
     
    5. ALDH2 mediates 5-nitrofuran activity in multiple species
    L Zhou, H Ishizaki, M Spitzer, KL Taylor - Chemistry & Biology, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch