.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ah5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Hydrolase, haloacid dehalogenase-like family protein SP0104 from Streptococcus pneumoniae. To be Published
    Site MCSG
    PDB Id 2ah5 Target Id APC80188
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5583,AAK74291, 170187 Molecular Weight 23392.19 Da.
    Residues 210 Isoelectric Point 4.84
    Sequence mtsitaiffdldgtlvdssigihnaftytfkelgvpspdaktirgfmgpplessfatclskdqiseavq iyrsyykakgiyeaqlfpqiidlleelsssyplyitttkdtstaqdmaknleihhffdgiygsspeaph kadvihqalqthqlapeqaiiigdtkfdmlgaretgiqklaitwgfgeqadllnyqpdyiahkplevla yfq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.74 Rfree 0.22934
    Matthews' coefficent 2.50 Rfactor 0.19595
    Waters 174 Solvent Content 50.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ah5
    1. Structural and Kinetic Characterization of the LPS Biosynthetic Enzyme d-_, _-d-Heptose-1, 7-bisphosphate Phosphatase (GmhB) from Escherichia coli
    PL Taylor, S Sugiman-Marangos, K Zhang - Biochemistry, 2010 - ACS Publications
     
    2. Analysis of Protein Structure using Geometric and Machine Learning Techniques
    A Tendulkar - 2007 - it.iitb.ac.in
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch