.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ahr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structures of Delta(1)-Pyrroline-5-carboxylate Reductase from Human Pathogens Neisseria meningitides and Streptococcus pyogenes. J.Mol.Biol. 354 91-106 2005
    Site MCSG
    PDB Id 2ahr Target Id APC28530
    Related PDB Ids 2amf 
    Molecular Characteristics
    Source Streptococcus pyogenes m1 gas
    Alias Ids TPS5409,AAK33229, 160490 Molecular Weight 27304.15 Da.
    Residues 256 Isoelectric Point 6.43
    Sequence mkigiigvgkmasaiikglkqtpheliisgsslerskeiaeqlalpyamshqdlidqvdlvilgikpql fetvlkplhfkqpiismaagislqrlatfvgqdlpllrimpnmnaqilqsstaltgnalvsqelqarvr dltdsfgstfdisekdfdtftalagsspayiylfiealakagvkngipkakaleivtqtvlasasnlkt ssqsphdfidaicspggttiaglmelerlgltatvssaidktidkaksl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 2.15 Rfree 0.20965
    Matthews' coefficent 2.88 Rfactor 0.1733
    Waters 668 Solvent Content 57.00

    Ligand Information
    Ligands NAP (NADP) x 5;FMT (FORMIC) x 5
    Metals NA (SODIUM) x 5

    Jmol

     
    Google Scholar output for 2ahr
    1. Crystal structure of human pyrroline-5-carboxylate reductase
    Z Meng, Z Lou, Z Liu, M Li, X Zhao, M Bartlam - Journal of molecular , 2006 - Elsevier
     
    2. Structural biology of proline catabolism
    JJ Tanner - Amino acids, 2008 - Springer
     
    3. Crystal Structures of _ 1-Pyrroline-5-carboxylate Reductase from Human Pathogens Neisseria meningitides and Streptococcus pyogenes
    B Nocek, C Chang, H Li, L Lezondra, D Holzle - Journal of molecular , 2005 - Elsevier
     
    4. De-orphaning the structural proteome through reciprocal comparison of evolutionarily important structural features
    RM Ward, S Erdin, TA Tran, DM Kristensen - PloS one, 2008 - dx.plos.org
     
    5. Dimeric Crystal Structure of Rabbit l-Gulonate 3-Dehydrogenase/[lambda]-Crystallin: Insights into the Catalytic Mechanism
    Y Asada, C Kuroishi, Y Ukita, R Sumii, S Endo - Journal of molecular , 2010 - Elsevier
     
    6. TA Binkowski, A Joachimiak - BMC structural biology, 2008 - BioMed Central Ltd
    30
     
    7. The Yeast Ubr1 Ubiquitin Ligase Participates in a Prominent Pathway That Targets Cytosolic Thermosensitive Mutants for Degradation
    F Khosrow-Khavar, NN Fang, AHM Ng - G3: Genes| Genomes| , 2012 - g3journal.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch