The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of hypothetical protein PA2801 from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 2ali Target Id APC5055
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4665,AAG06189, 208964 Molecular Weight 14978.21 Da.
    Residues 134 Isoelectric Point 5.78
    Sequence madrqllhtahipvrwgdmdsyghvnntlyfqyleearvawfetlgidlegaaegpvvlqslhtylkpv vhpatvvvelyagrlgtsslvlehrlhtledpqgtygeghcklvwvrhaenrstpvpdsiraaia
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.22947
    Matthews' coefficent 1.90 Rfactor 0.1781
    Waters 107 Solvent Content 35.30

    Ligand Information
    Metals CL (CHLORIDE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch