.
The Open Protein Structure Annotation Network
PDB Keyword
.

2amf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structures of Delta(1)-Pyrroline-5-carboxylate Reductase from Human Pathogens Neisseria meningitides and Streptococcus pyogenes. J.Mol.Biol. 354 91-106 2005
    Site MCSG
    PDB Id 2amf Target Id APC28530
    Related PDB Ids 2ahr 
    Molecular Characteristics
    Source Streptococcus pyogenes m1 gas
    Alias Ids TPS5410,AAK33229, 160490 Molecular Weight 27304.15 Da.
    Residues 256 Isoelectric Point 6.43
    Sequence mkigiigvgkmasaiikglkqtpheliisgsslerskeiaeqlalpyamshqdlidqvdlvilgikpql fetvlkplhfkqpiismaagislqrlatfvgqdlpllrimpnmnaqilqsstaltgnalvsqelqarvr dltdsfgstfdisekdfdtftalagsspayiylfiealakagvkngipkakaleivtqtvlasasnlkt ssqsphdfidaicspggttiaglmelerlgltatvssaidktidkaksl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 2.20 Rfree 0.21542
    Matthews' coefficent 2.88 Rfactor 0.17333
    Waters 739 Solvent Content 57.00

    Ligand Information
    Ligands PRO x 10
    Metals NA (SODIUM) x 5

    Jmol

     
    Google Scholar output for 2amf
    1. Crystal structure of human pyrroline-5-carboxylate reductase
    Z Meng, Z Lou, Z Liu, M Li, X Zhao, M Bartlam - Journal of molecular , 2006 - Elsevier
     
    2. Structural biology of proline catabolism
    JJ Tanner - Amino acids, 2008 - Springer
     
    3. Crystal Structures of _ 1-Pyrroline-5-carboxylate Reductase from Human Pathogens Neisseria meningitides and Streptococcus pyogenes
    B Nocek, C Chang, H Li, L Lezondra, D Holzle - Journal of molecular , 2005 - Elsevier
     
    4. De-orphaning the structural proteome through reciprocal comparison of evolutionarily important structural features
    RM Ward, S Erdin, TA Tran, DM Kristensen - PloS one, 2008 - dx.plos.org
     
    5. Plant P5C reductase as a new target for aminomethylenebisphosphonates
    G Forlani, S Giberti, L Berlicki - Journal of agricultural , 2007 - ACS Publications
     
    6. Structure of an Amide Bond Forming F420:[gamma][gamma]-glutamyl Ligase from Archaeoglobus Fulgidus-A Member of a New Family of Non-ribosomal Peptide
    B Nocek, E Evdokimova, M Proudfoot - Journal of molecular , 2007 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    2ahr.png
    No description
    46.42 kB22:12, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch