.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ao9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a Phage protein (phBC6A51) from Bacillus cereus ATCC 14579. To be Published
    Site MCSG
    PDB Id 2ao9 Target Id APC22852
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5241,AAP08864, 226900 Molecular Weight 17847.63 Da.
    Residues 155 Isoelectric Point 5.76
    Sequence mpfsisgrkgsemmakldelkqkltakqiqaayllvenelmesnneekrtqdemanelginrttlwewr tknqdfiafksevadsflaekreqvysklmqlilgpqpsvkamqlymqrfglltdkkviegdlgnatrt naeieeqlqklkkltge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.23581
    Matthews' coefficent 2.67 Rfactor 0.20494
    Waters 971 Solvent Content 53.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ao9
    1. Structural basis for DNA recognition and loading into a viral packaging motor
    CR Bttner, M Chechik - Proceedings of the , 2012 - National Acad Sciences
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch