.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ap1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the putative regulatory protein. To be Published
    Site MCSG
    PDB Id 2ap1 Target Id APC23343
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS5264,NP_460190, 99287 Molecular Weight 33057.81 Da.
    Residues 303 Isoelectric Point 5.09
    Sequence myygfdiggtkialgvfdstrrlqwekrvptphtsysafldavcelveeadqrfgvkgsvgigipgmpe tedgtlyaanvpaasgkplradlsarldrdvrldndancfalseawddeftqyplvmglilgtgvgggl vlngkpitgqsyitgefghmrlpvdaltlmgfdfplrrcgcgqmgcienylsgrgfawlyqhyydqslq apeiialweqgdeqahahveryldllavclgniltivdpdllviggglsnftaittqlaerlprhllpv araprierarhgdaggmrgaaflhltd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.20508
    Matthews' coefficent 2.60 Rfactor 0.16753
    Waters 292 Solvent Content 53.10

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 1;ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2ap1
    1. Divergent evolution of function in the ROK sugar kinase superfamily: role of enzyme loops in substrate specificity
    M Larion, LB Moore, SM Thompson, BG Miller - Biochemistry, 2007 - ACS Publications
     
    2. Evolutionary bases of carbohydrate recognition and substrate discrimination in the ROK protein family
    MS Conejo, SM Thompson, BG Miller - Journal of molecular evolution, 2010 - Springer
     
    3. COLLEGE OF ARTS AND SCIENCES
    M Larion - 2009 - diginole.lib.fsu.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch