.
The Open Protein Structure Annotation Network
PDB Keyword
.

2arh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Hypothetical Protein Aq_1966 from Aquifex aeolicus VF5. To be Published
    Site MCSG
    PDB Id 2arh Target Id APC22262
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS5216,NP_214347, 224324 Molecular Weight 23789.04 Da.
    Residues 201 Isoelectric Point 5.95
    Sequence mvkyeellktlenginseegeirlvrksqgrfkeefnfdlslgskplltlkvflgrkpywqpwvevfgv npnlrnvffgseaerklyeflsehfgrifveyfedkettyelqkgvppalsrlgfellklgytyfrdwy ipeglmegghkiqaekpkteeakkrhlenlkkefeefigkcedeglikkvkerynflehegss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.46 Rfree 0.29006
    Matthews' coefficent 2.50 Rfactor 0.2262
    Waters 205 Solvent Content 50.00

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals CA (CALCIUM) x 1;SE (SELENIUM) x 2

    Jmol

     
    Google Scholar output for 2arh
    1. One scaffold, three binding modes: novel and selective pteridine reductase 1 inhibitors derived from fragment hits discovered by virtual screening
    CP Mpamhanga, D Spinks, LB Tulloch - Journal of medicinal , 2009 - ACS Publications
     
    2. A knowledge-driven approach for crystallographic protein model completion
    K Joosten, SX Cohen, P Emsley, W Mooij - Section D: Biological , 2008 - scripts.iucr.org
     
    3. Synthesis, molecular modeling studies, and selective inhibitory activity against monoamine oxidase of N, N_-bis [2-oxo-2 H-benzopyran]-3-
    F Chimenti, D Secci, A Bolasco, P Chimenti - Bioorganic & medicinal , 2006 - Elsevier
     
    4. Identification of pharmacophore model, synthesis and biological evaluation of N-phenyl-1-arylamide and N-phenylbenzenesulfonamide derivatives as BACE 1
    W Huang, H Yu, R Sheng, J Li, Y Hu - Bioorganic & medicinal chemistry, 2008 - Elsevier
     
    5. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch