.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ark

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a flavodoxin from Aquifex aeolicus. To be Published
    Site MCSG
    PDB Id 2ark Target Id APC22280
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS5220,NP_214435, 224324 Molecular Weight 20442.50 Da.
    Residues 185 Isoelectric Point 5.83
    Sequence mgkvlviydtrtgntkkmaelvaegarslegtevrlkhvdeatkedvlwadglavgsptnmglvswkmk rffddvlgdlwgeidgkiacafsssggwgggnevacmsiltmlmnfgflvfgvtdyvgkkftlhygavv ageprseeekeacrrlgrrlaewvaifvdgrkellekirkdparfvd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.40 Rfree 0.23519
    Matthews' coefficent 2.30 Rfactor 0.17079
    Waters 420 Solvent Content 45.00

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 6;GOL (GLYCEROL) x 6
    Metals

    Jmol

     
    Google Scholar output for 2ark
    1. Large-scale evaluation of protein reductive methylation for improving protein crystallization
    Y Kim, P Quartey, H Li, L Volkart, C Hatzos, C Chang - Nature , 2008 - nature.com
     
    2. Crystal structure of an apo form of Shigella flexneri ArsH protein with an NADPH_dependent FMN reductase activity
    II Vorontsov, G Minasov, JS Brunzelle - Protein , 2007 - Wiley Online Library
     
    3. Heme biosynthesis is coupled to electron transport chains for energy generation
    K Mbius, R Arias-Cartin, D Breckau - Proceedings of the , 2010 - National Acad Sciences
     
    4. Structural organization of WrbA in apo-and holoprotein crystals
    J Wolfova, IK Smatanova, J Brynda, JR Mesters - et Biophysica Acta (BBA , 2009 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch