.
The Open Protein Structure Annotation Network
PDB Keyword
.

2as0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a novel SAM-dependent methyltransferase PH1915 from Pyrococcus horikoshii. Protein Sci. 14 3121-3128 2005
    Site MCSG
    PDB Id 2as0 Target Id APC5817
    Molecular Characteristics
    Source Pyrococcus horikoshii ot3
    Alias Ids TPS4854,BAA31040.1, 70601 Molecular Weight 44603.60 Da.
    Residues 396 Isoelectric Point 9.21
    Sequence marvvvdaqaaraigkgamivfkkgvvrvegdikpgdivevytrggkflgkgfanpnsnimvrivtkdk dveinkdlfkrrikkaneyrkkvlkytnvyrmvygeadylpglivdrfndiaslqissagmerfkldva eaimevepgietvfekntgrsrrreglpeiervllgkekyrtiiqegrakfivdmrgqktgffldqren rlalekwvqpgdrvldvftytggfaihaaiagadevigidkspraietakenaklngvedrmkfivgsa feemeklqkkgekfdivvldppafvqhekdlkaglrayfnvnfaglnlvkdggilvtcscsqhvdlqmf kdmiiaagakagkflkmlepyrtqapdhpilmaskdteylkclflyvedmr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.239
    Matthews' coefficent 2.24 Rfactor 0.207
    Waters 512 Solvent Content 44.63

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2as0
    1. YccW is the m5C methyltransferase specific for 23S rRNA nucleotide 1962
    E Purta, M O'Connor, JM Bujnicki - Journal of molecular , 2008 - Elsevier
     
    2. De novo backbone scaffolds for protein design
    JT MacDonald, K Maksimiak - Proteins: Structure, , 2010 - Wiley Online Library
     
    3. Crystal structure of the Escherichia coli 23S rRNA: m5C methyltransferase RlmI (YccW) reveals evolutionary links between RNA modification enzymes
    S Sunita, KL Tkaczuk, E Purta, JM Kasprzak - Journal of molecular , 2008 - Elsevier
     
    4. The crystal structure of a novel SAM_dependent methyltransferase PH1915 from Pyrococcus horikoshii
    W Sun, X Xu, M Pavlova, AM Edwards - Protein , 2005 - Wiley Online Library
     
    5. Identification and Characterization of the Thermus thermophilus 5-Methylcytidine (m5C) Methyltransferase Modifying 23 S Ribosomal RNA (rRNA) Base C1942
    LHG Larsen, A Rasmussen, AMB Giessing - Journal of Biological , 2012 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch